{"product_id":"proteintech-32970-1-ap","title":"Proteintech, 32970-1-AP, ADAM11 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ADAM11 (32970-1-AP) by Proteintech is a Polyclonal antibody targeting ADAM11 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n32970-1-AP targets ADAM11 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue, rat cerebellum tissue\nPositive IHC detected in: mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nADAM11 (A Disintegrin And Metalloprotease 11) is a non-catalytic, transmembrane member of the ADAM family. Although it retains the prototypical multi-domain architecture (signal peptide ‑ pro‑domain ‑ metalloprotease-like ‑ disintegrin ‑ cysteine-rich ‑ EGF-like ‑ TM ‑ cytoplasmic tail), it lacks the consensus HEXGHXXGXXHD zinc-binding motif, rendering it proteolytically inactive . Instead, ADAM11 functions as a cell-adhesion and signalling scaffold. (PMID: 31236626)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35877 Product name: Recombinant human ADAM11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 150-300 aa of NM_001318933 Sequence: STCQGLHGVFSDGNLTYIVEPQEVAGPWGAPQGPLPHLIYRTPLLPDPLGCREPGCLFAVPAQSAPPNRPRLRRKRQVRRGHPTVHSETKYVELIVINDHQLFEQMRQSVVLTSNFAKSVVNLADVIYKEQLNTRIVLVAMETWADGDKIQ Predict reactive species\nFull Name: ADAM metallopeptidase domain 11\nCalculated Molecular Weight: 83kDa\nObserved Molecular Weight: 83 kDa\nGenBank Accession Number: NM_001318933\nGene Symbol: ADAM11\nGene ID (NCBI): 4185\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O75078\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869801861289,"sku":"32970-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32970-1-ap","provider":"Iright","version":"1.0","type":"link"}