{"product_id":"proteintech-32983-1-ap","title":"Proteintech, 32983-1-AP, GBGT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GBGT1 (32983-1-AP) by Proteintech is a Polyclonal antibody targeting GBGT1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n32983-1-AP targets GBGT1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, OVCAR-3 cells,  SKOV-3 cells,  mouse ovary tissue,  rat ovary tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGBGT1 (Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1) gene is located on chromosome 9 (9q34) and comprises 347 amino acids. GBGT1 is the most differentially expressed glycogene involved in the biosynthesis of Fs antigen and GBGT1 is differentially methylated and associated with inflammatory bowel disease (PMID: 25294702). GBGT1 mRNA expression has been observed in a variety of human tissues being highest in placenta and ovary (PMID: 31933576).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38506 Product name: Recombinant human GBGT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 185-347 aa of NM_021996.5 Sequence: ETISQHIAKRAHREVDYLFCLDVDMVFRNPWGPETLGDLVAAIHPSYYAVPRQQFPYERRRVSTAFVADSEGDFYYGGAVFGGQVARVYEFTRGCHMAILADKANGIMAAWREESHLNRHFISNKPSKVLSPEYLWDDRKPQPPSLKLIRFSTLDKDISCLRS Predict reactive species\nFull Name: globoside alpha-1,3-N-acetylgalactosaminyltransferase 1\nCalculated Molecular Weight: 40kDa，347aa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: NM_021996.5\nGene Symbol: GBGT1\nGene ID (NCBI): 26301\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8N5D6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887648198825,"sku":"32983-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-32983-1-ap","provider":"Iright","version":"1.0","type":"link"}