{"product_id":"proteintech-33022-1-ap","title":"Proteintech, 33022-1-AP, B3GALT5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe B3GALT5 (33022-1-AP) by Proteintech is a Polyclonal antibody targeting B3GALT5 in WB, ELISA applications with reactivity to human, mouse, rat samples\n33022-1-AP targets B3GALT5 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-29 cells, mouse small intestine tissue,  rat small intestine tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nB3GALT5 (β-1,3-galactosyltransferase 5) is a key glycosyltransferase enzyme. It is responsible for catalyzing the synthesis of the terminal glycan structure, the sialyl Lewis X antigen. This antigen serves as an important ligand for selectin family proteins, mediating cell adhesion in both physiological and pathological processes. Its core function lies in regulating cell migration. In immunology, it influences lymphocyte homing; in oncology, its aberrant upregulation promotes the synthesis of sLe^x, leading to the adhesion of cancer cells to vascular endothelium via the \"selectin-ligand\" recognition system. This represents a critical initial step in tumor hematogenous metastasis, such as to the liver or lungs.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37977 Product name: Recombinant human B3GALT5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 29-310 aa of BC104862 Sequence: NPFKEQSFVYKKDGNFLKLPDTDCRQTPPFLVLLVTSSHKQLAERMAIRQTWGKERTVKGKQLKTFFLLGTTSSAAETKEVDQESQRHGDIIQKDFLDVYYNLTLKTMMGIEWVHRFCPQAAFVMKTDSDMFINVDYLTELLLKKNRTTRFFTGFLKLNEFPIRQPFSKWFVSKSEYPWDRYPPFCSGTGYVFSGDVASQVYNVSKSVPYIKLEDVFVGLCLERLNIRLEELHSQPTFFPGGLRFSVCLFRRIVACHFIKPRTLLDYWQALENSRGEDCPPV Predict reactive species\nFull Name: UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5\nCalculated Molecular Weight: 310 aa, 36 kDa\nObserved Molecular Weight: 44 kDa\nGenBank Accession Number: BC104862\nGene Symbol: B3GALT5\nGene ID (NCBI): 10317\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9Y2C3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885170413737,"sku":"33022-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-33022-1-ap","provider":"Iright","version":"1.0","type":"link"}