{"product_id":"proteintech-33033-1-ap","title":"Proteintech, 33033-1-AP, ZNF589 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZNF589 (33033-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF589 in IP, ELISA applications with reactivity to human, mouse samples\n33033-1-AP targets ZNF589 in IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: mouse liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZNF589(Zinc Finger Protein 589) is a protein coding gene located at 19q13.43 in human genome, belonging to C2H2 zinc finger protein family. Most members of this family appear in the form of \"KRAB-ZNF\", that is, the N-terminal has a KRAB(Krüppel-associated box) transcription inhibitory domain, and the C-terminal is a DNA binding domain composed of multiple C2H2 zinc fingers connected in series. ZNF589 also follows this classic structure: KRAB-A\/B box at N end, middle linker, and 11 continuous C2H2 zinc fingers at C end. Because KRAB domain can recruit KAP1\/TRIM28 and other co-inhibitory complexes, ZNF589 is generally regarded as a potential transcription inhibitor. GTEx data showed that the expression of ZNF589 was low to moderate in almost all adult tissues, with the highest expression in testis, ovary, thyroid, spleen, peripheral blood leukocytes and embryonic stem cells (hESC).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36351 Product name: Recombinant human ZNF589 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 76-250 aa of BC166625 Sequence: ESKPEVHTCPSCPLAFGSQQFLSQDELHNHPIPGFHAGNQLHPGNPCPEDQPQSQHPSDKNHRGAEAEDQRVEGGVRPLFWSTNERGALVGFSSLFQRPPISSWGGNRILEIQLSPAQNASSEEVDRISKRAETPGFGAVTFGECALAFNQKSNLFRQKAVTAEKSSDKRQSQVC Predict reactive species\nFull Name: zinc finger protein 589\nObserved Molecular Weight: 47 kDa\nGenBank Accession Number: BC166625\nGene Symbol: ZNF589\nGene ID (NCBI): 51385\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q86UQ0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887950647465,"sku":"33033-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-33033-1-ap","provider":"Iright","version":"1.0","type":"link"}