{"product_id":"proteintech-33050-1-ap","title":"Proteintech, 33050-1-AP, BBIP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BBIP1 (33050-1-AP) by Proteintech is a Polyclonal antibody targeting BBIP1 in WB, ELISA applications with reactivity to human samples\n33050-1-AP targets BBIP1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, PANC-1 cells,  U-87 MG cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe BBIP1 protein is a key component of the BBSome complex and was identified due to its role in the pathogenesis of Bardet-Biedl syndrome (BBS). This protein localizes to the base of cellular cilia and plays an indispensable role in ciliary assembly, maintenance, and signal transduction.\nAs an adapter for membrane protein trafficking, BBIP1 works in coordination with other members of the BBSome to precisely transport specific cargo proteins into the cilium, an important cellular organelle. Loss of its function disrupts the stability of the BBSome complex, leading to abnormalities in ciliary structure and function. This, in turn, causes various clinical symptoms of BBS, including retinal degeneration, obesity, and polydactyly. Therefore, research on BBIP1 is central to understanding the molecular basis of cilia-related diseases (ciliopathies).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36924 Product name: Recombinant human BBIP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-92 aa of BC015550 Sequence: MLKAAAKRPELSGKNTISNNSDMAEVKSMFREVLPKQGPLFVEDIMTMVLCKPKLLPLKSLTLEKLEKMHQAAQNTIRQQEMAEKDQRQITH* Predict reactive species\nFull Name: non-protein coding RNA 81\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC015550\nGene Symbol: NCRNA00081\nGene ID (NCBI): 92482\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: A8MTZ0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885185683625,"sku":"33050-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-33050-1-ap","provider":"Iright","version":"1.0","type":"link"}