{"product_id":"proteintech-33056-1-ap","title":"Proteintech, 33056-1-AP, TRMT10B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRMT10B (33056-1-AP) by Proteintech is a Polyclonal antibody targeting TRMT10B in WB, ELISA applications with reactivity to human samples\n33056-1-AP targets TRMT10B in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HAP1 cells, HL-60 cells,  HeLa cells,  Raji cells,  SH-SY5Y cells,  SK-N-SH cells,  THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe TRM10 family of methyltransferases is responsible for the N1-methylation of purines at position 9 of tRNAs in Archaea and Eukarya. The human genome encodes three TRM10-type enzymes. TRMT10B is the first m1A9-specific tRNA methyltransferase found in eukaryotes and is responsible for the modification of a single nuclear-encoded tRNA. Furthermore, we show that the lack of G9 methylation causes a decrease in the steady-state levels of the initiator tRNAiMet-CAT and an alteration in its further post-transcriptional modification (PMID: 32392304).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36835 Product name: Recombinant human RG9MTD3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-140 aa of BC012175 Sequence: MDWKLEGSTQKVESPVLQGQEGILEETGEDGLPEGFQLLQIDAEGECQEGEILATGSTAWCSKNVQRKQRHWEKIVAAKKSKRKQEKERRKANRAENPGICPQHSKRFLRALTKDKLLEAKHSGPRLCIDLSMTHYMSKK Predict reactive species\nFull Name: RNA (guanine-9-) methyltransferase domain containing 3\nCalculated Molecular Weight: 36 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC012175\nGene Symbol: RG9MTD3\nGene ID (NCBI): 158234\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q6PF06\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887839465641,"sku":"33056-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-33056-1-ap","provider":"Iright","version":"1.0","type":"link"}