{"product_id":"proteintech-33108-1-ap","title":"Proteintech, 33108-1-AP, SLC26A9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC26A9 (33108-1-AP) by Proteintech is a Polyclonal antibody targeting SLC26A9 in WB, IP, ELISA applications with reactivity to human, mouse samples\n33108-1-AP targets SLC26A9 in WB, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse stomach tissue\nPositive IP detected in: BxPC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSolute carrier family 26 member 9 (SLC26A9) is one out of 11 proteins that belong to the SLC26A family of anion transporters. Apart from expression in the gastrointestinal tract, SLC26A9 is also found in the respiratory system, in male tissues and in the skin. SLC26A9 has gained attention because of its modifier role in the gastrointestinal manifestation of cystic fibrosis (CF). SLC26A9 appears to have an impact on the extent of intestinal obstruction caused by meconium ileus. SLC26A9 supports duodenal bicarbonate secretion, but was assumed to provide a basal Cl- secretory pathway in airways. (PMID: 36866602). SLC26A9 was shown to be located at the luminal side of lung bronchiolar and alveolar epithelium (PMID: 11834742).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37313 Product name: Recombinant human SLC26A9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-70 aa of BC151208 Sequence: MSQPRPRYVVDRAAYSLTLFDDEFEKKDRTYPVGEKLRNAFRCSSAKIKAVVFGLLPVLSWLPNYKIKDY Predict reactive species\nFull Name: solute carrier family 26, member 9\nCalculated Molecular Weight: 791 aa, 87 kDa\nObserved Molecular Weight: 100-115 kDa\nGenBank Accession Number: BC151208\nGene Symbol: SLC26A9\nGene ID (NCBI): 115019\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q7LBE3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887805517993,"sku":"33108-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-33108-1-ap","provider":"Iright","version":"1.0","type":"link"}