{"product_id":"proteintech-33203-1-ap","title":"Proteintech, 33203-1-AP, TMEM209 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM209 (33203-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM209 in WB, ELISA applications with reactivity to human, mouse, rat samples\n33203-1-AP targets TMEM209 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, Jurkat cells,  human testis tissue,  mouse testis tissue,  rat testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTransmembrane protein 209 (TMEM209) is a nuclear envelope protein that interacts with nucleoporin protein NUP205, and may be involved in nuclear transport of various nuclear proteins in addition to MYC (PMID: 22719065). Additionally, TMEM209 is implicated in the regulation of the Wnt\/β-catenin signaling pathway, which is often activated in hepatocellular carcinoma (HCC) and contributes to tumor progression (PMID: 39414762).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34162 Product name: Recombinant human TMEM209 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 210-362 aa of BC045618 Sequence: VESSGLRSRYRSSPTVYNSPTDKEDYMTDLRTLDTFLRSEEEKQHRVKLGSPDSTSPSSSPTFWNYSRSMGDYAQTLKKFQYQLACRSQAPCANKDEADLSSKQAAEEVWARVAMNRQLLDHMDSWTAKFRNWINETILVPLVQEIESVSTQM Predict reactive species\nFull Name: transmembrane protein 209\nCalculated Molecular Weight: 561 aa, 63 kDa\nObserved Molecular Weight: 63 kDa\nGenBank Accession Number: BC045618\nGene Symbol: TMEM209\nGene ID (NCBI): 84928\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q96SK2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887831863465,"sku":"33203-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-33203-1-ap","provider":"Iright","version":"1.0","type":"link"}