{"product_id":"proteintech-33254-1-ap","title":"Proteintech, 33254-1-AP, NDRG4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NDRG4 (33254-1-AP) by Proteintech is a Polyclonal antibody targeting NDRG4 in WB, ELISA applications with reactivity to human, mouse, rat samples\n33254-1-AP targets NDRG4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse cerebellum tissue,  rat brain tissue,  rat cerebellum tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNDRG4 (N-myc downstream-regulated gene 4) is a member of the NDRG family (NDRG1-4), a group of evolutionarily conserved proteins implicated in cell differentiation, stress responses, and tumor suppression. Unlike other family members (e.g., NDRG1 linked to cancer metastasis), NDRG4 is highly expressed in the brain and heart, with emerging roles in neuronal development and cardiovascular function. Methylation of NDRG4 in stool DNA is a diagnostic marker for colorectal cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38351 Product name: Recombinant human NDRG4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 42-223 aa of BC011795 Sequence: NHKLCFNTFFNFEDMQEITKHFVVCHVDAPGQQVGASQFPQGYQFPSMEQLAAMLPSVVQHFGFKYVIGIGVGAGAYVLAKFALIFPDLVEGLVLVNIDPNGKGWIDWAATKLSGLTSTLPDTVLSHLFSQEELVNNTELVQSYRQQIGNVVNQANLQLFWNMYNSRRDLDINRPGTVPNAK Predict reactive species\nFull Name: NDRG family member 4\nCalculated Molecular Weight: 339 aa, 37 kDa\nObserved Molecular Weight: 37 kDa, 38 kDa and 41 kDa\nGenBank Accession Number: BC011795\nGene Symbol: NDRG4\nGene ID (NCBI): 65009\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9ULP0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887733919913,"sku":"33254-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-33254-1-ap","provider":"Iright","version":"1.0","type":"link"}