{"product_id":"proteintech-33262-1-ap","title":"Proteintech, 33262-1-AP, ASB12 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ASB12 (33262-1-AP) by Proteintech is a Polyclonal antibody targeting ASB12 in WB, ELISA applications with reactivity to human, mouse, rat samples\n33262-1-AP targets ASB12 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skeletal muscle tissue, mouse testis tissue,  rat skeletal musle tissue,  rat testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe ankyrin repeat and SOCS box (ASB) family is composed of 18 proteins from ASB1 to ASB18 and belongs to the suppressor of cytokine signaling (SOCS) box protein superfamily. ASB family proteins interact with Cul5-Rbx2 to form E3 Ub ligases and play significant roles via a ubiquitination-mediated pathway (PMID: 16325183). The calculated molecular weight of ASB12 in mice or rat was 34 kda. ASB12 may be ubiquitinated, resulting in an increase in the observed molecular quantity.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36991 Product name: Recombinant human ASB12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 12-161 aa of BC069436 Sequence: LLQPDKEEEDTDTEEKQALNQAVYDNDSYTLDQLLRQERYKRFINSRSGWGVPGTPLRLAASYGHLSCLQVLLAHGADVDSLDVKAQTPLFTAVSHGHLDCVRVLLEAGASPGGSIYNNCSPVLTAARDGAVAILQELLDHGAEANVKAK Predict reactive species\nFull Name: ankyrin repeat and SOCS box-containing 12\nCalculated Molecular Weight: 309 aa, 34 kDa\/318 aa, 35 kDa\nObserved Molecular Weight: 34,39 kDa\nGenBank Accession Number: BC069436\nGene Symbol: ASB12\nGene ID (NCBI): 142689\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8WXK4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885072011433,"sku":"33262-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-33262-1-ap","provider":"Iright","version":"1.0","type":"link"}