{"product_id":"proteintech-33358-1-ap","title":"Proteintech, 33358-1-AP, GPR37L1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GPR37L1 (33358-1-AP) by Proteintech is a Polyclonal antibody targeting GPR37L1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n33358-1-AP targets GPR37L1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGPR37L1 (G Protein-Coupled Receptor 37 Like 1) is a protein that belongs to the large and diverse family of G protein-coupled receptors (GPCRs). GPCRs are crucial cellular sensors, spanning the cell membrane to transmit signals from the outside to the inside of the cell, governing virtually every physiological process. The apparent molecular weight is larger than the calculated molecular weight of 53 kDa, which is likely due to posttranslational modification, presumably by glycosylation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36603 Product name: Recombinant human GPR37L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 26-134 aa of NM_004767.3 Sequence: APLHLGRHRAETQEQQSRSKRGTEDEEAKGVQQYVPEEWAEYPRPIHPAGLQPTKPLVATSPNPGKDGGTPDSGQELRGNLTGAPGQRLQIQNPLYPVTESSYSAYAIM Predict reactive species\nFull Name: G protein-coupled receptor 37 like 1\nCalculated Molecular Weight: 53kDa，481aa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: NM_004767.3\nGene Symbol: GPR37L1\nGene ID (NCBI): 9283\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O60883\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887657570473,"sku":"33358-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-33358-1-ap","provider":"Iright","version":"1.0","type":"link"}