{"product_id":"proteintech-33364-1-ap","title":"Proteintech, 33364-1-AP, ATP6V0D2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATP6V0D2 (33364-1-AP) by Proteintech is a Polyclonal antibody targeting ATP6V0D2 in WB, ELISA applications with reactivity to human, mouse, rat samples\n33364-1-AP targets ATP6V0D2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, rat kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nATP6V0D2 is a subunit of the vacuolar proton-translocating ATPase (V-ATPase) complex, which is responsible for acidifying intracellular compartments and the extracellular environment. This protein is crucial for maintaining the acidic environment necessary for various cellular processes, including bone resorption by osteoclasts (PMID: 19113919). ATP6V0D2 is also involved in the regulation of tumor-associated macrophages, where it influences tumor progression through the lactate\/ATP6V0D2\/HIF-2α axis (PMID: 30431439).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38739 Product name: Recombinant human ATP6V0D2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 238-349 aa of BC065207 Sequence: ETLYPTFGKLYPEGLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQMNVLAFNRQFHYGVFYAYVKLKEQEIRNIVWIAECISQRHRTKINSYIPI Predict reactive species\nFull Name: ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2\nCalculated Molecular Weight: 40 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC065207\nGene Symbol: ATP6V0D2\nGene ID (NCBI): 245972\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8N8Y2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885120082089,"sku":"33364-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-33364-1-ap","provider":"Iright","version":"1.0","type":"link"}