{"product_id":"proteintech-33366-1-ap","title":"Proteintech, 33366-1-AP, MED29 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MED29 (33366-1-AP) by Proteintech is a Polyclonal antibody targeting MED29 in WB, IHC, IP, ELISA applications with reactivity to human samples\n33366-1-AP targets MED29 in WB, IHC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, HT-29 cells\nPositive IP detected in: HT-29 cells\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMediator of RNA polymerase II transcription subunit 29 (MED29) is also named as Mediator complex subunit 29 and Intersex-like protein (IXL). MED29 is one of the most highly conserved proteins across species and is widely expressed in humans both during embryonic development and in adult tissues (PMID: 15555573). MED29 was overexpressed in pancreatic cancer and promoted pancreatic cancer cell viability (PMID: 21225629, PMID: 17332321). MED29 facilitated the epithelial-mesenchymal transition process in OSCC, thereby promoting migration and invasion (PMID: 39462350).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38949 Product name: Recombinant human MED29 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of NM_017592.2 Sequence: MAASQQQASAASSAAGVSGPSSAGGPGPQQQPQPPAQLVGPAQSGLLQQQQQDFDPVQRYKMLIPQLKESLQTLMKVAAQNLIQNTNIDNGQKSSDGPIQRFDKCLEEFYALCDQLELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQISCAKDIHTALLDCANKVTGKTPAPPAGPGGTL Predict reactive species\nFull Name: mediator complex subunit 29\nCalculated Molecular Weight: 21kDa，200aa\nObserved Molecular Weight: 21-25 kDa\nGenBank Accession Number: NM_017592.2\nGene Symbol: MED29\nGene ID (NCBI): 55588\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9NX70\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887715930281,"sku":"33366-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-33366-1-ap","provider":"Iright","version":"1.0","type":"link"}