{"product_id":"proteintech-33419-1-ap","title":"Proteintech, 33419-1-AP, CD70 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD70 (33419-1-AP) by Proteintech is a Polyclonal antibody targeting CD70 in WB, ELISA applications with reactivity to mouse, rat samples\n33419-1-AP targets CD70 in WB, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse thymus tissue, rat thymus tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD70, also known as tumor necrosis factor ligand superfamily member 7 (TNFSF7) or CD27 ligand (CD27L), is a transmembrane protein that plays a significant role in the immune system. It is the unique ligand for CD27, a member of the tumor necrosis factor receptor (TNFR) family, and is transiently upregulated upon stimulation of immune cells. CD70 is expressed on lymphocytes and dendritic cells, and its expression can be regulated by activation signals received via toll-like receptors (TLRs), CD40, and the antigen receptor MHC II. It provides complex and not completely understood signaling for B cell development. CD70 is also expressed on various solid tumors and hematolymphoid malignancies, where it may contribute to a poor prognosis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg5287 Product name: recombinant rat CD70\/CD27 Ligand protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 46-195 aa of NM_001106878.1 Sequence: QHVLLEPPELHVAELQLNLTDPQKDLTLRWGAGPALGRSFTHGPGLEKGNLRIHQDGIYRLHIQVTLANCSSSGSALQHRASLVVGICSPAVHIISLLRRRFGQDCTVSLQRLTPLARGDVLCSNLTQPLLPSRNADETFFGVQRVYPWP Predict reactive species\nFull Name: Cd70 molecule\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: NM_001106878.1\nGene Symbol: Cd70\nGene ID (NCBI): 301132\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: A6KQR5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886313394345,"sku":"33419-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-33419-1-ap","provider":"Iright","version":"1.0","type":"link"}