{"product_id":"proteintech-33432-1-ap","title":"Proteintech, 33432-1-AP, MPZL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MPZL1 (33432-1-AP) by Proteintech is a Polyclonal antibody targeting MPZL1 in WB, ELISA applications with reactivity to mouse, rat samples\n33432-1-AP targets MPZL1 in WB, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMPZL1(myelin protein zero like 1, also known as PZR) is a transmembrane glycoprotein of immunoglobulin superfamily, whose core function is to mediate cell adhesion and signal transduction. By recruiting molecules such as SHP-2, it regulates Src, TGF-β and other pathways, and its abnormality is closely related to tumor metastasis, neurological diseases and so on.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg6820 Product name: Recombinant mouse MPZL1 protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 36-162 aa of NM_001083897.1 Sequence: SALEVHTPKEIFVVNGTQGKLTCTFDSPNTTGWLTTVSWSFQPDGTDSAVSFFHYSQGQVYIGDYPPFKDRVTWAGDLDKKDASINIENIQAVHNGTYICDVKNPPDIVVRPGHIRLHVVEIDNLLV Predict reactive species\nFull Name: myelin protein zero-like 1\nCalculated Molecular Weight: 29 kDa\nObserved Molecular Weight: 27-29 kDa\nGenBank Accession Number: NM_001083897.1\nGene Symbol: Mpzl1\nGene ID (NCBI): 68481\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q3TEW6-1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887723696297,"sku":"33432-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-33432-1-ap","provider":"Iright","version":"1.0","type":"link"}