{"product_id":"proteintech-33447-1-ap","title":"Proteintech, 33447-1-AP, RPP25L Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RPP25L (33447-1-AP) by Proteintech is a Polyclonal antibody targeting RPP25L in WB, ELISA applications with reactivity to human samples\n33447-1-AP targets RPP25L in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A-204 cells, A431 cells,  BxPC-3 cells,  DU 145 cells,  Raji cells,  Ramos cells,  THP-1 cells,  U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRPP25L (Ribonuclease P protein subunit p25-like protein), also known as C9orf23. RPP25L is a subunit of RNase P complex, which is mainly involved in the processing of tRNA precursor, and is responsible for cutting off the 5' leading sequence of tRNA precursor to generate mature tRNA. In addition, RPP25L may also participate in other RNA metabolism processes, such as the processing of rRNA.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37795 Product name: Recombinant human C9orf23 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-163 aa of BC032136 Sequence: MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEGGSARHVVFSGSGRAAGKAVSCAEIVKRRVPGLHQLTKLRFLQTEDSWVPASPDTGLDPLTVRRHVPAVWVLLSRDPLDPNECGYQPPGAPPGLGSMPSSSCGPRSRRRARDTRS Predict reactive species\nFull Name: chromosome 9 open reading frame 23\nObserved Molecular Weight: 17-19 kDa\nGenBank Accession Number: BC032136\nGene Symbol: C9orf23\nGene ID (NCBI): 138716\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8N5L8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887788380329,"sku":"33447-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-33447-1-ap","provider":"Iright","version":"1.0","type":"link"}