{"product_id":"proteintech-33483-1-ap","title":"Proteintech, 33483-1-AP, WDSOF1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe WDSOF1 (33483-1-AP) by Proteintech is a Polyclonal antibody targeting WDSOF1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n33483-1-AP targets WDSOF1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells\nPositive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWDSOF1 (WD repeat and SOF1 domain-containing 1, also known as DCAF13) functions as a substrate receptor subunit for the CRL4-DDB1 E3 ubiquitin ligase complex. It contains WD40 repeat clusters and is primarily localized in the nucleolus, where it participates in the processing of 40S ribosomal RNA precursors and the regulation of the estrogen receptor. Recent research has revealed its indispensable role in uterine development: its deficiency leads to the downregulation of estrogen target genes, an increase in H3K9me3 levels, failure of embryo implantation, and complete infertility in female mice. Furthermore, WDSOF1 is located at 8q22.3, a genomic region frequently amplified in tumors. It is highly expressed in various cancers, including liver and breast cancer, and is associated with poor prognosis, positioning it as an oncogenic factor and a potential therapeutic target.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35559 Product name: Recombinant human WDSOF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 249-597 aa of BC112042 Sequence: TQRNCIRTIQAHEGFVRGICTRFCGTSFFTVGDDKTVKQWKMDGPGYGDEEEPLHTILGKTVYTGIDHHWKEAVFATCGQQVDIWDEQRTNPICSMTWGFDSISSVKFNPIETFLLGSCASDRNIVLYDMRQATPLKKVILDMRTNTICWNPMEAFIFTAANEDYNLYTFDMRALDTPVMVHMDHVSAVLDVDYSPTGKEFVSASFDKSIRIFPVDKSRSREVYHTKRMQHVICVKWTSDSKYIMCGSDEMNIRLWKANASEKLGVLTSREKAAKDYNQKLKEKFQHYPHIKRIARHRHLPKSIYSQIQEQRIMKEARRRKEVNRIKHSKPGSVPLVSEKKKHVVAVVK Predict reactive species\nFull Name: WD repeats and SOF1 domain containing\nCalculated Molecular Weight: 597 aa, 67 kDa\nObserved Molecular Weight: 60 kDa\nGenBank Accession Number: BC112042\nGene Symbol: WDSOF1\nGene ID (NCBI): 25879\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9NV06\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887923351721,"sku":"33483-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-33483-1-ap","provider":"Iright","version":"1.0","type":"link"}