{"product_id":"proteintech-33489-1-ap","title":"Proteintech, 33489-1-AP, PTCHD4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PTCHD4 (33489-1-AP) by Proteintech is a Polyclonal antibody targeting PTCHD4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n33489-1-AP targets PTCHD4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse cerebellum tissue,  rat brain tissue,  rat cerebellum tissue\nPositive IHC detected in: rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPTCHD4 (Patched Domain-Containing Protein 4; formerly C6orf138) is a 96 kDa multi-pass transmembrane protein encoded at 6p12.3 that belongs to the Patched family of cholesterol\/lipid transporters .\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37091 Product name: Recombinant human C6orf138 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 150-323 aa of BC137359 Sequence: SDGANIINLLASDSPSVSYAMVQQKYFSNYSPVIGFYVYEPLEYWNSSVQDDLRRLCSGFTAVSWVEQYYQFLKVSNVSANNKSDFISVLQSSFLKKPEFQHFRNDIIFSKAGDESNIIASRLYLVARTSRDKQKEITEVLEKLRPLSLSKSIRFIVFNPSFVFMDHYSLSVTV Predict reactive species\nFull Name: chromosome 6 open reading frame 138\nObserved Molecular Weight: 90 kDa\nGenBank Accession Number: BC137359\nGene Symbol: C6orf138\nGene ID (NCBI): 442213\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q6ZW05\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887776583849,"sku":"33489-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-33489-1-ap","provider":"Iright","version":"1.0","type":"link"}