{"product_id":"proteintech-33499-1-ap","title":"Proteintech, 33499-1-AP, GPR175 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GPR175 (33499-1-AP) by Proteintech is a Polyclonal antibody targeting GPR175 in WB, ELISA applications with reactivity to human samples\n33499-1-AP targets GPR175 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, human placenta tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGPR175, also known as TPRA1 or TPRA40, is a transmembrane protein. GPR175 was first cloned as a GLP-1 receptor homolog in 3T3-L1 adipocytes and is also expressed in tissues that require Hh signaling during development, including the heart, brain, lung, pancreas, and muscle. Endogenous GPR175 localizes to cilia in a Hh-dependent manner, where it can interact with (constitutively) ciliary Gαi1 to inhibit the local production of cAMP by adenylyl cyclase. The calculated molecular weight of GPR175 is 41 kDa. With glycosylation modification, the molecular weight of GPR175 will be migrated to 55 kDa. (PMID: 26451044)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag39379 Product name: Recombinant human GPR175 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 286-373 aa of BC050711 Sequence: SEPKILFSYKCQVDETEEPDVHLPQPYAVARREGLEAAGAAGASAASYSSTQFDSAGGVAYLDDIASMPCHTGSINSTDSERWKAINA Predict reactive species\nFull Name: G protein-coupled receptor 175\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC050711\nGene Symbol: GPR175\nGene ID (NCBI): 131601\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q86W33\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887657177257,"sku":"33499-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-33499-1-ap","provider":"Iright","version":"1.0","type":"link"}