{"product_id":"proteintech-33500-1-ap","title":"Proteintech, 33500-1-AP, WDR42A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe WDR42A (33500-1-AP) by Proteintech is a Polyclonal antibody targeting WDR42A in WB, ELISA applications with reactivity to human samples\n33500-1-AP targets WDR42A in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, HeLa cells,  THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWD repeat-containing protein 42A (WDR42A), also named DDB1- and CUL4- associated factor 8 (DCAF8), is a member of the WD40-repeat proteins (PMID: 22500989). WDR42A is a nucleocytoplasmic shuttling protein. WDR42A acts as a substrate receptor for the CUL4-DDB1 E3 ubiquitin-protein ligase complex, which is involved in protein ubiquitination (Uniprot).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38765 Product name: Recombinant human WDR42A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC099709 Sequence: MSSKGSSTDGRTDLANGSLSSSPEEMSGAEEGRETSSGIEVEASDLSLSLTGDDGGPNRTSTESRGTDTESSGEDKDSDSMEDTGHYSINDENRVHDRSE Predict reactive species\nFull Name: WD repeat domain 42A\nCalculated Molecular Weight: 597 aa, 67 kDa\nObserved Molecular Weight: 67-73 kDa\nGenBank Accession Number: BC099709\nGene Symbol: WDR42A\nGene ID (NCBI): 50717\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q5TAQ9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887922663593,"sku":"33500-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-33500-1-ap","provider":"Iright","version":"1.0","type":"link"}