{"product_id":"proteintech-33515-1-ap","title":"Proteintech, 33515-1-AP, SBF1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SBF1 (33515-1-AP) by Proteintech is a Polyclonal antibody targeting SBF1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n33515-1-AP targets SBF1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells, Ramos cells,  mouse brain tissue,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSbf1, a pseudophosphatase of the myotubularin family, is expressed at high levels in seminiferous tubules of the testis, specifically in Sertoli's cells, spermatogonia, and pachytene spermatocytes, but not in postmeiotic round spermatids. Mice that are nullizygous for Sbf1 exhibit male infertility characterized by azoospermia. Faint bands in some lanes around 150 kDa represent apparent Sbf1 degradation products (PMID: 11994405).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38267 Product name: Recombinant human SBF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1300-1430 aa of CCDS93186.1 Sequence: AGRDALAPPQANGGPPDPGFLRPQRAALYILGDKAQLKGVRSDPLQQWELVPIEVFEARQVKASFKKLLKACVPGCPAAEPSPASFLRSLEDSEWLIQIHKLLQVSVLVVELLDSGSSVLVGLEDGWDITT Predict reactive species\nFull Name: SET binding factor 1\nCalculated Molecular Weight: 208kDa，1868aa\nObserved Molecular Weight: 210 kDa, 140 kDa\nGenBank Accession Number: CCDS93186.1\nGene Symbol: SBF1\nGene ID (NCBI): 6305\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O95248\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887792967849,"sku":"33515-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-33515-1-ap","provider":"Iright","version":"1.0","type":"link"}