{"product_id":"proteintech-33589-1-ap","title":"Proteintech, 33589-1-AP, SFRS15 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SFRS15 (33589-1-AP) by Proteintech is a Polyclonal antibody targeting SFRS15 in WB, ELISA applications with reactivity to human samples\n33589-1-AP targets SFRS15 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSCAF4 is an mRNA anti-terminator protein that plays a crucial role in regulating transcription by RNA Polymerase II. It functions by binding to the phosphorylated CTD of Pol II and interacting with splicing factors to suppress premature transcription termination, particularly at genes with complex structures. This activity ensures proper transcriptional readthrough and full-length mRNA production, thereby influencing gene expression critical for cellular homeostasis. Dysregulation of SCAF4-mediated anti-termination is implicated in disrupted mRNA processing and potential disease states.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37951 Product name: Recombinant human SFRS15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 991-1147 aa of BC064990 Sequence: FNSGRDQERFGRRSFGNRVENDRERYGNRNDDRDNSNRDRREWGRRSPDRDRHRDLEERNRRSSGHRDRERDSRDRESRREKEEARGKEKPEVTDRAGGNKTVEPPISQVGNVDTASELEKGVSEAAVLKPSEELPAEATSSVEPEKDSGSAAEAPR Predict reactive species\nFull Name: splicing factor, arginine\/serine-rich 15\nObserved Molecular Weight: 150 kDa\nGenBank Accession Number: BC064990\nGene Symbol: SFRS15\nGene ID (NCBI): 57466\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O95104\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887798800553,"sku":"33589-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-33589-1-ap","provider":"Iright","version":"1.0","type":"link"}