{"product_id":"proteintech-33595-1-ap","title":"Proteintech, 33595-1-AP, NCAPH2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NCAPH2 (33595-1-AP) by Proteintech is a Polyclonal antibody targeting NCAPH2 in WB, ELISA applications with reactivity to human, mouse samples\n33595-1-AP targets NCAPH2 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, PC-12 cells,  J774A.1 cells,  RAW 264.7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNCAPH2 is a subunit of the condensin-2 complex involved in chromosome condensation during mitosis and meiosis. Peripheral blood DNA methylation levels in the NCAPH2\/LMF2 promoter region were significantly decreased in patients with AD and those with amnestic mild cognitive impairment (aMCI); therefore, these are considered to be a potentially useful biomarker for the diagnosis of AD. (PMID: 33603659)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38706 Product name: Recombinant mouse Ncaph2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 450-607 aa of NM_001115132 Sequence: VMPEEAADLDAEAMPESLRYEELVRRNVELFIATSQKFIQETELSQRIRDWEDTIQPLLQEQEQHVPFDIHIYGDQLASRFPQLNEWCPFSELVAGQPAFEVCRSMLASLQLANDYTVEITQQPGLEAAVDTMSLRLLTHQRAHTRFQTYAAPSMAQP* Predict reactive species\nFull Name: non-SMC condensin II complex, subunit H2\nCalculated Molecular Weight: 69 kDa\nObserved Molecular Weight: 68-80 kDa\nGenBank Accession Number: NM_001115132\nGene Symbol: Ncaph2\nGene ID (NCBI): 52683\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8BSP2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887733428393,"sku":"33595-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-33595-1-ap","provider":"Iright","version":"1.0","type":"link"}