{"product_id":"proteintech-33601-1-ap","title":"Proteintech, 33601-1-AP, TMEM155 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM155 (33601-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM155 in WB, IP, ELISA applications with reactivity to human, mouse, rat, pig samples\n33601-1-AP targets TMEM155 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue,  pig brain tissue\nPositive IP detected in: mouse brain tissue, pig brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag39858 Product name: Recombinant human TMEM155 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-63 aa of NM_001384332.1 Sequence: MEWELNLLLYLALFFFLLFLLFLLLFVVIKQLKNSVANTAGALQPGRLSVHREPWGFSREQAV Predict reactive species\nFull Name: transmembrane protein 155\nCalculated Molecular Weight: 7 kDa，63aa\nObserved Molecular Weight: 10-15 kDa\nGenBank Accession Number: NM_001384332.1\nGene Symbol: TMEM155\nGene ID (NCBI): 132332\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q4W5P6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887830651049,"sku":"33601-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-33601-1-ap","provider":"Iright","version":"1.0","type":"link"}