{"product_id":"proteintech-33605-1-ap","title":"Proteintech, 33605-1-AP, ZZEF1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZZEF1 (33605-1-AP) by Proteintech is a Polyclonal antibody targeting ZZEF1 in WB, ELISA applications with reactivity to human, mouse samples\n33605-1-AP targets ZZEF1 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse liver tissue,  mouse heart tissue,  mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZZEF1 is a large cytoplasmic protein distinguished by a ZZ-type zinc finger and an EF-hand calcium-binding domain, hinting at a role in linking protein-protein interactions with calcium-mediated signaling. Its functions are not fully elucidated, but growing evidence suggests involvement in cilia formation, cytoskeletal organization, and cell signaling regulation. Mutations or dysregulation of ZZEF1 have been linked to ciliopathies, tumor biology, and possible neurodevelopmental conditions, making it a gene of emerging biomedical interest. (PMID: 33227311)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35406 Product name: Recombinant human ZZEF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2480-2600 aa of BC151836 Sequence: ILRAIYELQMKKTDYFFLEVQKRFDGDELTTDERIRSLAQRWQPSKSLRLEEQSAKAVDTDMIILPCLSRPARCDQATAESNPVTQKLISSTESELQQSYAKQRRSKSAALLHKELNCKSK Predict reactive species\nFull Name: zinc finger, ZZ-type with EF-hand domain 1\nObserved Molecular Weight: 300-330 kDa\nGenBank Accession Number: BC151836\nGene Symbol: ZZEF1\nGene ID (NCBI): 23140\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O43149\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887955005609,"sku":"33605-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-33605-1-ap","provider":"Iright","version":"1.0","type":"link"}