{"product_id":"proteintech-33633-1-ap","title":"Proteintech, 33633-1-AP, TRABD Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRABD (33633-1-AP) by Proteintech is a Polyclonal antibody targeting TRABD in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n33633-1-AP targets TRABD in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, human testis tissue,  mouse brain tissue,  rat brain tissue\nPositive IP detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTraB domain-containing protein (TRABD) is also named TTG2. TRABD is a Tiki\/TraB family protein that is highly expressed in the brains of patients with AD (PMID: 33446646). TRABD as a novel outer mitochondrial membrane protein. Depletion of TRABD in cells severely impairs mitochondrial respiration and ATP production, inhibits cell growth, increases reactive oxygen species levels (PMID: 40778267).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag40480 Product name: Recombinant human TRABD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-85 aa of BC093029 Sequence: MDGEEQQPPHEANVEPVVPSEASEPVPRVLSGDPQNLSDVDAFNLLLEMKLKRRRQRPNLPRTVTQLVAEDGSRVYVVGTAHFSD Predict reactive species\nFull Name: TraB domain containing\nObserved Molecular Weight: 37 kDa\nGenBank Accession Number: BC093029\nGene Symbol: TRABD\nGene ID (NCBI): 80305\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9H4I3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887836778665,"sku":"33633-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-33633-1-ap","provider":"Iright","version":"1.0","type":"link"}