{"product_id":"proteintech-33739-1-ap","title":"Proteintech, 33739-1-AP, WDHD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe WDHD1 (33739-1-AP) by Proteintech is a Polyclonal antibody targeting WDHD1 in WB, ELISA applications with reactivity to human, mouse samples\n33739-1-AP targets WDHD1 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, A549 cells,  Calu-1 cells,  MCF-7 cells,  MDA-MB-231 cells,  NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe WD repeat and HMG-box DNA-binding protein 1 (WDHD1), also known as acidic nucleoplasmic DNA-binding protein 1 (AND-1), is a DNA‐binding protein with a total molecular weight of 126 kDa, containing multiple N-terminal WD40 domains and a C-terminal high mobility group (HMG) box. WDHD1 contains the highly conserved SepB domain, which plays a crucial role in DNA replication processes(PMID: 37569867). WDHD1 regulates the assembly and activation of the pre‐replication complex (pre-RC), and WDHD1 depletion leads to G1 stagnation and delays progression to the S phase(PMID: 36345604).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38697 Product name: Recombinant human WDHD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 950-1129 aa of NM_007086.3 Sequence: SRTTNNEKSPIIKPLIPKPKPKQASAASYFQKRNSQTNKTEEVKEENLKNVLSETPAICPPQNTENQRPKTGFQMWLEENRSNILSDNPDFSDEADIIKEGMIRFRVLSTEERKVWANKAKGETASEGTEAKKRKRVVDESDETENQEEKAKENLNLSKKQKPLDFSTNQKLSAFAFKQE* Predict reactive species\nFull Name: WD repeat and HMG-box DNA binding protein 1\nCalculated Molecular Weight: 126kDa，1129aa\nObserved Molecular Weight: 126 kDa\nGenBank Accession Number: NM_007086.3\nGene Symbol: WDHD1\nGene ID (NCBI): 11169\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O75717\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887922008233,"sku":"33739-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-33739-1-ap","provider":"Iright","version":"1.0","type":"link"}