{"product_id":"proteintech-33839-1-ap","title":"Proteintech, 33839-1-AP, Trem2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Trem2 (33839-1-AP) by Proteintech is a Polyclonal antibody targeting Trem2 in WB, ELISA applications with reactivity to mouse samples\n33839-1-AP targets Trem2 in WB, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse heart tissue,  mouse lung tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTrem2 (triggering receptor expressed on myeloid cells 2), a trigger receptor 2 expressed by myeloid cells, is an important immunoregulatory receptor, mainly expressed on the surface of myeloid cells such as macrophages and microglia, and plays a key role in maintaining immune homeostasis, regulating inflammation and the occurrence and development of various diseases. Trem2 is highly expressed in tumor-associated macrophages (TAMs), which plays a role in promoting tumor by inhibiting anti-tumor immunity and promoting tumor angiogenesis, thus becoming a potential target of tumor immunotherapy.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag40690 Product name: Recombinant mouse Trem2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 19-171 aa of BC052784 Sequence: LNTTVLQGMAGQSLRVSCTYDALKHWGRRKAWCRQLGEEGPCQRVVSTHGVWLLAFLKKRNGSTVIADDTLAGTVTITLKNLQAGDAGLYQCQSLRGREAEVLQKVLVEVLEDPLDDQDAGDLWVPEESSSFEGAQVEHSTSRNQETSFPPTS Predict reactive species\nFull Name: triggering receptor expressed on myeloid cells 2\nObserved Molecular Weight: 27 kDa\nGenBank Accession Number: BC052784\nGene Symbol: Trem2\nGene ID (NCBI): 83433\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q99NH8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887838023849,"sku":"33839-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-33839-1-ap","provider":"Iright","version":"1.0","type":"link"}