{"product_id":"proteintech-33854-1-ap","title":"Proteintech, 33854-1-AP, SSBP3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SSBP3 (33854-1-AP) by Proteintech is a Polyclonal antibody targeting SSBP3 in WB, ELISA applications with reactivity to human, mouse, rat, pig samples\n33854-1-AP targets SSBP3 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse spleen tissue, mouse thymus tissue,  rat spleen tissue,  rat thymus tissue,  pig thymus tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSSBP 3 (single-stranded DNA binding protein 3) is a kind of nuclear transcription co-activator. Its core function is to regulate embryonic development, islet β cell function and gene expression by binding single-stranded DNA and participating in transcription regulation complex. Its abnormality is related to diseases such as metabolism and tumor.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag40791 Product name: Recombinant human SSBP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 335-388 aa of BC066365 Sequence: LGSGDIDGLPKNSPNNISGISNPPGTPRDDGELGGNFLHSFQNDNYSPSMTMSV Predict reactive species\nFull Name: single stranded DNA binding protein 3\nCalculated Molecular Weight: 40 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC066365\nGene Symbol: SSBP3\nGene ID (NCBI): 23648\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9BWW4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887816888489,"sku":"33854-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-33854-1-ap","provider":"Iright","version":"1.0","type":"link"}