{"product_id":"proteintech-33895-1-ap","title":"Proteintech, 33895-1-AP, REG3G Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe REG3G (33895-1-AP) by Proteintech is a Polyclonal antibody targeting REG3G in WB, ELISA applications with reactivity to human, mouse samples\n33895-1-AP targets REG3G in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse pancreas tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nREG3G (Regenerating Islet-Derived 3 Gamma) is a small intestinal C-type lectin-like antimicrobial peptide mainly secreted by Paneth cells.  First identified in regenerating pancreas, it is now recognized as a key defender of the gut barrier: it kills Gram-positive bacteria, limits bacterial contact with the epithelium, and thus helps prevent systemic inflammation and metabolic disease.\nBeyond its antimicrobial role, REG3G acts as a gut-derived hormone that links the intestinal microbiome to host metabolism.  Its expression is boosted by dietary fiber, beneficial bacteria, interleukin-22 (IL-22) and bariatric surgery, and it reciprocally improves glucose control, reduces hepatic steatosis, accelerates wound healing and protects pancreatic β-cells by activating the JAK2\/STAT3 pathway .  Conversely, chronic alcohol intake or dysbiosis lowers REG3G levels, weakening the gut barrier and promoting alcoholic liver disease.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35686 Product name: Recombinant human REG3G protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 27-175 aa of BC103854 Sequence: EETQKELPSPRISCPKGSKAYGSPCYALFLSPKSWMDADLACQKRPSGKLVSVLSGAEGSFVSSLVRSISNSYSYIWIGLHDPTQGSEPDGDGWEWSSTDVMNYFAWEKNPSTILNPGHCGSLSRSTGFLKWKDYNCDAKLPYVCKFKD Predict reactive species\nFull Name: regenerating islet-derived 3 gamma\nCalculated Molecular Weight: 19 kDa\nObserved Molecular Weight: 18 kDa\nGenBank Accession Number: BC103854\nGene Symbol: REG3G\nGene ID (NCBI): 130120\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q6UW15\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887782219945,"sku":"33895-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-33895-1-ap","provider":"Iright","version":"1.0","type":"link"}