{"product_id":"proteintech-33956-1-ap","title":"Proteintech, 33956-1-AP, ZAN Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZAN (33956-1-AP) by Proteintech is a Polyclonal antibody targeting ZAN in WB, IP, ELISA applications with reactivity to human, mouse samples\n33956-1-AP targets ZAN in WB, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse testis tissue\nPositive IP detected in: mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZAN (Zonadhesin) is a sperm-specific type-I transmembrane glycoprotein essential for species-restricted binding between spermatozoa and the egg's zona pellucida. First isolated from boar sperm, it is expressed solely in post-meiotic male germ cells (early spermatids) and localises to the apical segment of the sperm head.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35843 Product name: Recombinant human ZAN protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 18-200 aa of NM_003386 Sequence: RKEKPPDQKLVVRSSRDNYVLTQCDFEDDAKPLCDWSQVSADDEDWVRASGPSPTGSTGAPGGYPNGEGSYLHMESNSFHRGGVARLLSPDLWEQGPLCVHFAHHMFGLSWGAQLRLLLLSGEEGRRPDVLWKHWNTQRPSWMLTTVTVPAGFTLPTRLMFEGTRGSTAYLDIALDALSIRRG Predict reactive species\nFull Name: zonadhesin\nCalculated Molecular Weight: 305kDa\nObserved Molecular Weight: 230 kDa\nGenBank Accession Number: NM_003386\nGene Symbol: ZAN\nGene ID (NCBI): 7455\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9Y493\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887926464681,"sku":"33956-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-33956-1-ap","provider":"Iright","version":"1.0","type":"link"}