{"product_id":"proteintech-34182-1-ap","title":"Proteintech, 34182-1-AP, FDX1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FDX1 (34182-1-AP) by Proteintech is a Polyclonal antibody targeting FDX1 in WB, ELISA applications with reactivity to mouse, rat samples\n34182-1-AP targets FDX1 in WB, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue, rat testis tissue,  mouse testis tissue,  rat liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFerredoxin 1 (FDX1) is a small mitochondrial protein and recent studies have shown that FDX1 plays an important role in tumor cuproptosis. FDX1 expression is significantly downregulated in HCC tissues. FDX1 downregulation promotes HCC cell proliferation, invasion in vitro and growth, metastasis in vivo. In addition, FDX1 affects metabolism of HCC cells and is associated with autophagy (PMID: 39128228). FDX1 is localized to the mitochondria and contains a 64-amino-acid mitochondrial transit peptide that is cleaved during post-translational processing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag41687 Product name: Recombinant mouse FDX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 64-184 aa of NM_007996 Sequence: DKITVHFINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS Predict reactive species\nFull Name: ferredoxin 1\nCalculated Molecular Weight: 20 kDa\nObserved Molecular Weight: 15 kDa\nGenBank Accession Number: NM_007996\nGene Symbol: Fdx1\nGene ID (NCBI): 14148\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P46656\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887638106281,"sku":"34182-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-34182-1-ap","provider":"Iright","version":"1.0","type":"link"}