{"product_id":"proteintech-50430-2-ap","title":"Proteintech, 50430-2-AP, GFP tag Polyclonal antibody","description":"Size: 150ul\nThe GFP tag (50430-2-AP) by Proteintech is a Polyclonal antibody targeting GFP tag in WB, IF\/ICC, IF-P, IP, ELISA applications with reactivity to aequorea victoria, recombinant protein samples\n50430-2-AP targets GFP tag in WB, IHC, IF\/ICC, IF-P, IP, CoIP, ChIP, RIP, IP-MS, ELISA applications and shows reactivity with aequorea victoria, recombinant protein samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: recombinant protein, Transfected HEK-293 cells\nPositive IP detected in: Transfected HEK-293T cells\nPositive IF-P detected in: transgenic mouse brain tissue\nPositive IF\/ICC detected in: Transfected HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGreen Fluorescent Proteins (GFPs) encompass a diverse range of proteins carrying a green chromophore, originating from various species and forming different protein lineages.Wildtype GFP consists of 238 amino acid residues (26.9 kDa). GFP was first identified in the jellyfish Aequorea victoria. It emits green light with a peak wavelength of 509 nm upon excitation by blue light at 395 nm.When fused with other proteins, GFP serves as a versatile reporter protein e.g. for quantifying expression levels or facilitates visualization of subcellular localization through fluorescence microscopy.This antibody is a rabbit polyclonal antibody, generated against the full-length eGFP protein. It exhibits reactivity towards variants of Aequorea victoria GFP, including S65T-GFP, RS-GFP, YFP, CFP, and eGFP.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: aequorea victoria, recombinant protein\nCited Reactivity: mouse, rat, pig, canine, yeast, escherichia coli, silkworm\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2128 Product name: Recombinant aequorea victoria GFP tag protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-238 aa of M62653 Sequence: MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK Predict reactive species\nFull Name: GFP tag\nCalculated Molecular Weight: 26 kDa\nGenBank Accession Number: M62653\nRRID: AB_11042881\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P42212\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868817772713,"sku":"50430-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-50430-2-ap","provider":"Iright","version":"1.0","type":"link"}