{"product_id":"proteintech-51027-2-ap","title":"Proteintech, 51027-2-AP, MECR Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MECR (51027-2-AP) by Proteintech is a Polyclonal antibody targeting MECR in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n51027-2-AP targets MECR in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, mouse skeletal muscle tissue,  mouse stomach tissue,  rat heart tissue\nPositive IP detected in: mouse heart tissue\nPositive IF\/ICC detected in: C2C12 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMitochondrial Trans-2-Enoyl-CoA Reductase is abbrivated as MECR, involved in human mitochonrial fatty acid synthesis(mtFAS) as an oxidoreductase. (PMID: 27817865) MECR has molecular weight can be calculated around 37KDa. With immunopercipitation reaction on mouse heart samples, the IgG heavy chain, dimer of MECR is around 65KDa. Numerous studies have shown disorder of lipid metabolism is closely related with malignance, especially in liver cancer. As futher research suggests that MECR has close realitionship with cell prolifereation, appotosis, and metastasis (PMID: 31178528)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, yeast\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0465 Product name: Recombinant mouse Mecr protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 117-373 aa of BC003864 Sequence: SSVSALKPGDWVIPANAGLGTWRTEAVFSEEALIGIPKDIPLQSAATLGVNPCTAYRMLVDFEQLQPGDSVIQNASNSGVGQAVIQIASALRLKTINVVRDRPDIKKLTDRLKDLGADYVLTEEELRMPETKTIFKDLPLPRLALNCVGGKSSTELLRHLAPGGTMVTYGGMAKQPVTASVSLLIFKDLKLRGFWLSQWKKNHSPDEFKELILTLCNLIRQGRLTAPSCSEVPLQGYQQALEASMKPFVSSKQILTM Predict reactive species\nFull Name: mitochondrial trans-2-enoyl-CoA reductase\nCalculated Molecular Weight: 40 kDa\nObserved Molecular Weight: 37-40 kDa\nGenBank Accession Number: BC003864\nGene Symbol: MECR\nGene ID (NCBI): 26922\nRRID: AB_615013\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9DCS3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868970078377,"sku":"51027-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-51027-2-ap","provider":"Iright","version":"1.0","type":"link"}