{"product_id":"proteintech-60008-1-ig","title":"Proteintech, 60008-1-Ig, Beta Actin Monoclonal antibody","description":"Size: 150ul\nThe Beta Actin (60008-1-Ig) by Proteintech is a Monoclonal antibody targeting Beta Actin in WB, IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat, zebrafish, plant samples\n60008-1-Ig targets Beta Actin in WB, IHC, IF\/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, zebrafish, plant samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: multi-cells\/tissue, HeLa cells,  MCF-7 cells,  HEK-293 cells,  A549 cells,  rice whole plant tissue,  arabidopsis whole plant tissue\nPositive IHC detected in: mouse heart tissue, human brain tissue,  human kidney tissue,  human lung tissue,  human ovary tissue,  human placenta tissue,  human spleen tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: rat brain tissue\nPositive IF\/ICC detected in: MDCK cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBeta actin, also named as ACTB and F-Actin, belongs to the actin family. Actins are highly conserved globular proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. At least six isoforms of actins are known in mammals and other vertebrates: alpha (ACTC1, cardiac muscle 1), alpha 1 (ACTA1, skeletal muscle) and 2 (ACTA2, aortic smooth muscle), beta (ACTB), gamma 1 (ACTG1) and 2 (ACTG2, enteric smooth muscle). Beta and gamma 1 are two non-muscle actin proteins. Most actins consist of 376aa, while ACTG2 (rich in muscles) has 375aa and ACTG1(found in non-muscle cells) has only 374aa. Beta actin has been widely used as the internal control in RT-PCR and Western Blotting as a 42-kDa protein. However, the 37-40 kDa cleaved fragment of beta actin can be generated during apoptosis process. This antibody can recognize all the actins.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, zebrafish, plant\nCited Reactivity: human, rat, chicken, goat, yeast, tick, arabidopsis, terminalia bellirica, rare minnow, cat\nHost \/ Isotype: Mouse \/ IgM\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag0297 Product name: Recombinant human beta actin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 14-167 aa of BC002409 Sequence: SGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYE Predict reactive species\nFull Name: actin, beta\nCalculated Molecular Weight: 375 aa, 42 kDa\nObserved Molecular Weight: 42 kDa\nGenBank Accession Number: BC002409\nGene Symbol: Beta Actin\nGene ID (NCBI): 60\nRRID: AB_2289225\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Caprylic acid\/ammonium sulfate precipitation\nUNIPROT ID: P60709\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887966769321,"sku":"60008-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-60008-1-ig","provider":"Iright","version":"1.0","type":"link"}