{"product_id":"proteintech-60024-1-ig","title":"Proteintech, 60024-1-Ig, S100A11 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe S100A11 (60024-1-Ig) by Proteintech is a Monoclonal antibody targeting S100A11 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n60024-1-Ig targets S100A11 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: T-47D cells, A431 cells,  BxPC-3 cells,  DU 145 cells\nPositive IHC detected in: human lung cancer tissue, human ovary tumor tissue,  human thyroid cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: BxPC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:3000\nImmunohistochemistry (IHC): IHC : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nS100A11, also named as MLN 70, Calgizzarin and S100C, belongs to the S-100 family. It facilitates the differentiation and the cornification of keratinocytes. The naming of S100A11 systematically arises from its membership of the S100 protein family, named after their solubility in 100% saturated ammonium sulfate solution. First discovered in 1989, S100A11 has since been proposed to have direct biological functions in an assortment of physiological processes such as endo- and exocytosis, regulation of enzyme activity, cell growth and regulation, apoptosis and inflammation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag0343 Product name: Recombinant human S100A11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 3-105 aa of BC001410 Sequence: KISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT Predict reactive species\nFull Name: S100 calcium binding protein A11\nCalculated Molecular Weight: 105 aa, 12 kDa\nObserved Molecular Weight: 12 kDa\nGenBank Accession Number: BC001410\nGene Symbol: S100A11\nGene ID (NCBI): 6282\nRRID: AB_2238821\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P31949\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888007925929,"sku":"60024-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-60024-1-ig","provider":"Iright","version":"1.0","type":"link"}