{"product_id":"proteintech-60041-1-ig","title":"Proteintech, 60041-1-Ig, DSE Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe DSE (60041-1-Ig) by Proteintech is a Monoclonal antibody targeting DSE in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n60041-1-Ig targets DSE in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDSE, also named as SART2 and DSEPI, is an enzyme that converts D-glucuronic acid to L-iduronic acid residues in dermatan sulphate biosynthesis. It is also identified to be a tumour-associated antigen. DSE is recognized by cytotoxic T cells (CTLs) and its enhanced expression in many cancers has been reported. DSE is a potential candidate for a tumour antigen with immunogenicity.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: mouse\nHost \/ Isotype: Mouse \/ IgM\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag0695 Product name: Recombinant human DSE protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 659-958 aa of BC039245 Sequence: RAAYLFIGPSIDVQSFTVHGDSQQLDVFIATSKHAYATYLWTGEATGQSAFAQVIADRHKILFDRNSAIKSSIVPEVKDYAAIVEQNLQHFKPVFQLLEKQILSRVRNTASFRKTAERLLRFSDKRQTEEAIDRIFAISQQQQQQSKSKKNRRAGKRYKFVDAVPDIFAQIEVNEKKIRQKAQILAQKELPIDEDEEMKDLLDFADVTYEKHKNGGLIKGRFGQARMVTTTHSRAPSLSASYTRLFLILNIAIFFVMLAMQLTYFQRAQSLHGQRCLYAVLLIDSCILLWLYSSCSQSQC Predict reactive species\nFull Name: dermatan sulfate epimerase\nCalculated Molecular Weight: 958 aa, 110 kDa\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: BC039245\nGene Symbol: DSE\nGene ID (NCBI): 29940\nRRID: AB_2093286\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Caprylic Acid-Ammonium Sulfate Precipitation\nUNIPROT ID: Q9UL01\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888040595625,"sku":"60041-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-60041-1-ig","provider":"Iright","version":"1.0","type":"link"}