{"product_id":"proteintech-60044-1-ig","title":"Proteintech, 60044-1-Ig, Transgelin 2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Transgelin 2 (60044-1-Ig) by Proteintech is a Monoclonal antibody targeting Transgelin 2 in WB, IHC, IF\/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse samples\n60044-1-Ig targets Transgelin 2 in WB, IHC, IF\/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K562 cells,  A549 cells,  HEK-293 cells,  MCF-7 cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human urothelial carcinoma tissue, human colon tissue,  human colon cancer tissue,  mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human colon cancer tissue\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe transgelin family is a group of proteins that belong to  22 kDa actin-related corpnin superfamily. Of all three isoforms, transgelin 1 is the best characterized. Transgelin 1, also known as SM22 alpha, is a specific marker for differentiated smooth muscle cells. Transgelin 2, also known as SM22 beta, is expressed by both smooth muscle and non-smooth muscle cells in a temporally and spatially regulated pattern. Trangenlin 3, also known as NP25, is only found in highly differentiated  neuronal cells. Our test result showed that this antibody Is specific to TAGLN2. It does not bind TAGLN1 and TAGLN3.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag0337 Product name: Recombinant human TAGLN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 4-130 aa of BC002616 Sequence: RGPAYGLSREVQQKIEKQYDADLEQILIQWITTQCRKDVGRPQPGRENFQNWLKDGTVLCELINAQYPEGQAPVKKIQASTMAFKQMEQISQFLQAAERYGINTTDIFQTVDLWEGKNMACVQRTLM Predict reactive species\nFull Name: transgelin 2\nCalculated Molecular Weight: 199 aa, 22 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC002616\nGene Symbol: Transgelin-2\/TAGLN2\nGene ID (NCBI): 8407\nRRID: AB_2271433\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P37802\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888017363113,"sku":"60044-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-60044-1-ig","provider":"Iright","version":"1.0","type":"link"}