{"product_id":"proteintech-60060-1-ig","title":"Proteintech, 60060-1-Ig, Follistatin Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Follistatin (60060-1-Ig) by Proteintech is a Monoclonal antibody targeting Follistatin in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n60060-1-Ig targets Follistatin in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  Raji cells,  U2OS cells,  SKOV-3 cells,  A549 cells,  NCI-H1299 cells,  Calu-3 cells\nPositive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFollistatin (FST) is a member of the tissue growth factor β family and is a secreted glycoprotein that antagonizes many members of the family, including activin A, growth differentiation factor11 , and myostatin. It binds activin A with high affinity and whose expression can be induced by activin A and several other pro-inflammatory cytokines. Activin A-follistatin complexes are biologically inactive and bind to cell surface heparan sulphate-containing proteoglycans for internalisation and degradation. It has also been found to play a significant role in the management of skeletal muscle size and mass. It also has important roles in early embryonic development, differentiation of ovarian granulosa cells, liver fibrosis and polycystic ovarian syndrome. FS 288 glycosylation results in a major species of 35 kDa and a less abundant 40 kDa and minor products of 40 and 42  kDa (PMID: 9785474). Three typical follistatin bands are at 32, 35, and 39 kDa (PMID: 2036994).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat, camel\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag0775 Product name: Recombinant human FST protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-344 aa of BC004107 Sequence: MVRARHQPGGLCLLLLLLCQFMEDRSAQAGNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCNSISEDTEEEEEDEDQDYSFPISSILEW Predict reactive species\nFull Name: follistatin\nCalculated Molecular Weight: 33 aa, 7 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC004107\nGene Symbol: Follistatin\nGene ID (NCBI): 10468\nRRID: AB_2106706\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P19883\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887998128297,"sku":"60060-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-60060-1-ig","provider":"Iright","version":"1.0","type":"link"}