{"product_id":"proteintech-60067-1-ig","title":"Proteintech, 60067-1-Ig, Neuropilin 1\/CD304 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Neuropilin 1\/CD304 (60067-1-Ig) by Proteintech is a Monoclonal antibody targeting Neuropilin 1\/CD304 in WB, IF\/ICC, ELISA applications with reactivity to human, pig, rabbit samples\n60067-1-Ig targets Neuropilin 1\/CD304 in WB, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, pig, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue, fetal human brain tissue,  human plasma,  37°C incubated human placenta tissue,  pig brain tissue,  HeLa cells,  rabbit heart tissue,  MDA-MB-231 cells,  A549 cells,  pig heart tissue\nPositive IF\/ICC detected in: SH-SY5Y cells,  human embronic stem cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNeuropilin-1 (NRP1) is a 130-140 kDa transmembrane glycoprotein expressed by endothelial, dendritic, and regulatory T cells, as well as several other normal cell types and malignant tumor cells. NRP1 was first identified as a semaphorin (SEMA) receptor, involved in axonal guidance in embryonic development. NRP1 was also shown to act as a receptor for vascular endothelial growth factor (VEGF) and a promoter of angiogenesis through its interaction with VEGF-A165 (and other VEGFs) and the receptor tyrosine kinase (RTK) VEGF-R2. NRP1 plays versatile roles in angiogenesis, axon guidance, cell survival, migration, and invasion.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, pig, rabbit\nCited Reactivity: human, mouse, rabbit, xenopus\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag0931 Product name: Recombinant human NRP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC007737 Sequence: MERGLPLLCAVLALVLAPAGAFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHGAGFSIRYEIFKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIVFAPKMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRIRSSSGILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCMEALGMESGEIHSDQITASSQYSTN Predict reactive species\nFull Name: neuropilin 1\nCalculated Molecular Weight: 103 kDa\nObserved Molecular Weight: 130 kDa\nGenBank Accession Number: BC007737\nGene Symbol: Neuropilin 1\nGene ID (NCBI): 8829\nRRID: AB_2150840\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O14786\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887983612073,"sku":"60067-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-60067-1-ig","provider":"Iright","version":"1.0","type":"link"}