{"product_id":"proteintech-60074-1-ig","title":"Proteintech, 60074-1-Ig, IFITM1-Specific Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe IFITM1-Specific (60074-1-Ig) by Proteintech is a Monoclonal antibody targeting IFITM1-Specific in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n60074-1-Ig targets IFITM1-Specific in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: TF-1 cells, K-562 cells,  human testis tissue,  HepG2 cells,  HL-60 cells\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: K-562 cells, Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:20000-1:100000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIFITM1(interferon induced transmembrane protein), also named DSPA2a and interferon-induced protein 17 (IFI17), belongs to the CD225 family. It has two transmembrane domain and serves as an IFN-induced antiviral protein that mediates cellular innate immunity to at least three major human pathogens, influenza A H1N1 virus, West Nile virus (WNV), and dengue virus , by inhibiting the early steps of replication. IFITM proteins are recently identified as viral restriction factors that inhibit infection mediated by the influenza A virus (IAV) hemagglutinin (HA) protein. Also they serve as important components of the innate immune system to restrict HIV-1 infection. 60074-1-Ig is a mouse monoclonal antibody which specifically recognizing IFITM1 but not IFITM2 or IFITM3.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, pig\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag2320 Product name: Recombinant human IFITM1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-125 aa of BC000897 Sequence: MHKEEHEVAVLGAPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY Predict reactive species\nFull Name: interferon induced transmembrane protein 1 (9-27)\nCalculated Molecular Weight: 14 kDa\nObserved Molecular Weight: 14-17 kDa\nGenBank Accession Number: BC000897\nGene Symbol: IFITM1\nGene ID (NCBI): 8519\nRRID: AB_2233405\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P13164\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887976599721,"sku":"60074-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-60074-1-ig","provider":"Iright","version":"1.0","type":"link"}