{"product_id":"proteintech-60094-2-ig","title":"Proteintech, 60094-2-Ig, PFN2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PFN2 (60094-2-Ig) by Proteintech is a Monoclonal antibody targeting PFN2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples\n60094-2-Ig targets PFN2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue,  rat brain tissue\nPositive IHC detected in: human lung cancer tissue,  human skeletal muscle tissue,  mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPFN2 (profilin 2) is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. The MW of this protein is 15 kDa, and this antibody specially recognises the 15 kDa protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag5043 Product name: Recombinant human PFN2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-140 aa of BC018049 Sequence: MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLALGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF Predict reactive species\nFull Name: profilin 2\nCalculated Molecular Weight: 140 aa, 15 kDa\nObserved Molecular Weight: 15 kDa\nGenBank Accession Number: BC018049\nGene Symbol: PFN2\nGene ID (NCBI): 5217\nRRID: AB_2163215\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P35080\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888001306793,"sku":"60094-2-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-60094-2-ig","provider":"Iright","version":"1.0","type":"link"}