{"product_id":"proteintech-60097-1-ig","title":"Proteintech, 60097-1-Ig, PCNA Monoclonal antibody","description":"Size: 150ul\nThe PCNA (60097-1-Ig) by Proteintech is a Monoclonal antibody targeting PCNA in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat, pig samples\n60097-1-Ig targets PCNA in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HepG2 cells,  HeLa cells,  Jurkat cells,  K-562 cells,  C6 cells,  ROS1728 cells,  NIH\/3T3 cells,  3T3-L1 cells,  4T1 cells,  RAW 264.7 cells\nPositive IP detected in: HepG2 cells\nPositive IHC detected in: human gliomas tissue, human breast cancer tissue,  human liver cancer tissue,  human placenta tissue,  human tonsillitis tissue,  mouse ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells, mouse heart tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProliferating Cell Nuclear Antigen, commonly known as PCNA, is a protein that acts as a processivity factor for DNA polymerase δ in eukaryotic cells. This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. PCNA induces a robust stimulatory effect on the 3'-5' exonuclease and 3'-phosphodiesterase, but not apurinic-apyrimidinic (AP) endonuclease, APEX2 activities. It has to be loaded onto DNA in order to be able to stimulate APEX2. PCNA protein is highly conserved during evolution; the deduced amino acid sequences of rat and human differ by only 4 of 261 amino acids. PCNA has been used as loading control for proliferating cells. The calculated molecular weight of PCNA is 29 kDa, but modified PCNA is 36kDa (PMID: 1358458).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human, mouse, rat, pig, rabbit, zebrafish\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag7416 Product name: Recombinant human PCNA protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 8-256 aa of BC000491 Sequence: QGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIE Predict reactive species\nFull Name: proliferating cell nuclear antigen\nCalculated Molecular Weight: 29 kDa\/31 kDa\nObserved Molecular Weight: 36-38 kDa\nGenBank Accession Number: BC000491\nGene Symbol: PCNA\nGene ID (NCBI): 5111\nRRID: AB_2236728\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P12004\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887970078889,"sku":"60097-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-60097-1-ig","provider":"Iright","version":"1.0","type":"link"}