{"product_id":"proteintech-60117-2-ig","title":"Proteintech, 60117-2-Ig, NR2F6 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe NR2F6 (60117-2-Ig) by Proteintech is a Monoclonal antibody targeting NR2F6 in WB, IHC, ELISA applications with reactivity to human, rat samples\n60117-2-Ig targets NR2F6 in WB, IHC, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HCT 116 cells, HeLa cells,  HT-29 cells,  LNCaP cells,  MCF-7 cells,  HEK-293 cells,  K-562 cells,  HSC-T6 cells\nPositive IHC detected in: human ovary tumor tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNR2F6 belongs to NR2F subfamily members, which have their roles in the regulation of neurogenesis, organogenesis, and cellular differentiation during embryonic development (PMID:15875024). NR2F6 acts as transcription factor by binding to a TGACCT direct-repeat motif and has been established in controlling facets of central nervous system (CNS) (PMID: 12690040). It is a nuclear attenuator that directly interferes with DNA binding of NF-AT and, subsequently, transcriptional activity of the NF-AT-dependent IL-17 expression. Otherwise, NR2F6 negatively interfered with transcriptional cytokine responses and acted as a barrier against autoimmunity (PMID:18701084).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag7614 Product name: Recombinant human NR2F6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-404 aa of BC002669 Sequence: MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRVGMRKEAVQRGRIPHSLPGAVAASSGSPPGSALAAVASGGDLFPGQPVSELIAQLLRAEPYPAAAGRFGAGGGAAGAVLGIDNVCELAARLLFSTVEWARHAPFFPELPVADQVALLRLSWSELFVLNAAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDSAEYGCLKAIALFTPDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRFGRLLLRLPALRAVPASLISQLFFMRLVGKTPIETLIRDMLLSGSTFNWPYGSGQ Predict reactive species\nFull Name: nuclear receptor subfamily 2, group F, member 6\nCalculated Molecular Weight: 43 kDa\nObserved Molecular Weight: 43 kDa\nGenBank Accession Number: BC002669\nGene Symbol: NR2F6\nGene ID (NCBI): 2063\nRRID: AB_2155653\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P10588\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888031355049,"sku":"60117-2-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-60117-2-ig","provider":"Iright","version":"1.0","type":"link"}