{"product_id":"proteintech-60178-1-ig","title":"Proteintech, 60178-1-Ig, BCL2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe BCL2 (60178-1-Ig) by Proteintech is a Monoclonal antibody targeting BCL2 in IHC, IF\/ICC, IF-P, IP, ELISA applications with reactivity to human, pig samples\n60178-1-Ig targets BCL2 in IHC, IF\/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: U-937 cells\nPositive IHC detected in: human appendicitis tissue, human lymphoma tissue,  human tonsillitis tissue,  Jurkat cellsNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human appendicitis tissue, human tonsillitis tissue\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:6400-1:25600\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\n1) What is Bcl-2?Bcl-2 (B-cell lymphoma 2) is an outer mitochondrial membrane protein that via heterodimerization with BAX proteins controls apoptosis. Abnormalities of Bcl-2 activity can lead to cancer, autoimmune diseases, and schizophrenia.2) FAQs for Bcl-2A) How to measure Bcl-2 and Bax apoptotic markers by western blottingGenerally, Bcl-2 protein is considered to have anti-apoptotic activity, while Bax has apoptotic activity. Comparing the ratio between Bcl-2 and Bax protein levels in different samples or cells subjected to treatments can reflect the apoptotic state of the cells. Expression of Bax can vary between cell lines and it is important to compare it to Bcl-2 levels.B) What band size should I expect in western blotting for Bcl-2?The molecular weight of Bcl-2 is 26 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, pig\nCited Reactivity: human, pig, rabbit, monkey, bovine, hamster\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag3508 Product name: Recombinant human BCL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-239 aa of BC027258 Sequence: MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK Predict reactive species\nFull Name: B-cell CLL\/lymphoma 2\nCalculated Molecular Weight: 26 kDa\nObserved Molecular Weight: 26 kDa\nGenBank Accession Number: BC027258\nGene Symbol: BCL2\nGene ID (NCBI): 596\nRRID: AB_10734459\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P10415\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.\nFAQ\nA) How to measure Bcl-2 and Bax apoptotic markers by western blottingGenerally, Bcl-2 protein is considered to have anti-apoptotic activity, while Bax has apoptotic activity. Comparing the ratio between Bcl-2 and Bax protein levels in different samples or cells subjected to treatments can reflect the apoptotic state of the cells. Expression of Bax can vary between cell lines and it is important to compare it to Bcl-2 levels.B) What band size should I expect in western blotting for Bcl-2?The molecular weight of Bcl-2 is 26 kDa.\nProtocolsProduct Specific ProtocolsIF protocol for BCL2 antibody 60178-1-IgDownload protocolIHC protocol for BCL2 antibody 60178-1-IgDownload protocolIP protocol for BCL2 antibody 60178-1-IgDownload protocolStandard ProtocolsClick here to view our Standard Protocols\nProtocolsProduct Specific ProtocolsIF protocol for BCL2 antibody 60178-1-IgDownload protocolIHC protocol for BCL2 antibody 60178-1-IgDownload protocolIP protocol for BCL2 antibody 60178-1-IgDownload protocolStandard ProtocolsClick here to view our Standard Protocols","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887968571561,"sku":"60178-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-60178-1-ig","provider":"Iright","version":"1.0","type":"link"}