{"product_id":"proteintech-60213-1-ig","title":"Proteintech, 60213-1-Ig, transgelin\/SM22 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe transgelin\/SM22 (60213-1-Ig) by Proteintech is a Monoclonal antibody targeting transgelin\/SM22 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig samples\n60213-1-Ig targets transgelin\/SM22 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig colon tissue, human colon tissue,  pig stomach tissue,  human stomach tissue,  rat colon tissue,  rat stomach tissue,  rabbit stomach tissue,  mouse colon tissue\nPositive IHC detected in: human colon tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse heart tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:400\nImmunofluorescence (IF)-P: IF-P : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe transgelin family is a group of proteins that belong to  22 kDa actin-related  corpnin superfamily. Of all three isoforms, transgelin 1 is the best characterized. Transgelin 1, also known as SM22 alpha, is a specific marker for differentiated smooth muscle cells. Transgelin 2, also known as SM22 beta, is expressed by both smooth muscle and non-smooth muscle cells in a temporally and spatially regulated pattern. Trangenlin 3, also known as NP25, is only found in highly differentiated  neuronal cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag0764 Product name: Recombinant human TAGLN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-201 aa of BC004927 Sequence: MANKGPSYGMSREVQSKIEKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQVAQFLKAAEDYGVIKTDMFQTVDLFEGKDMAAVQRTLMALGSLAVTKNDGHYRGDPNWFMKKAQEHKREFTESQLQEGKHVIGLQMGSNRGASQAGMTGYGRPRQIIS Predict reactive species\nFull Name: transgelin\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 18+22 kDa\nGenBank Accession Number: BC004927\nGene Symbol: transgelin\/SM22\nGene ID (NCBI): 6876\nRRID: AB_11043177\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q01995\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887985938601,"sku":"60213-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-60213-1-ig","provider":"Iright","version":"1.0","type":"link"}