{"product_id":"proteintech-60266-1-ig","title":"Proteintech, 60266-1-Ig, KIFAP3 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe KIFAP3 (60266-1-Ig) by Proteintech is a Monoclonal antibody targeting KIFAP3 in WB, IHC, ELISA applications with reactivity to human, mouse,   rat samples\n60266-1-Ig targets KIFAP3 in WB, IHC, ELISA applications and shows reactivity with human, mouse,   rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human testis tissue\nPositive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKIFAP3, also known as KIF3AP or KAP3, is a novel KIF3A\/3B-associated protein. It binds to the tail domain of KIF3A\/3B and may play a role in regulating the binding of KIF3A\/3B to cargoes. Recently it has been reported that mutation within the KIFAP3 gene is associated with decreased KIFAP3 expression and increased survival in sporadic ALS, which makes it a potential target for ALS therapy. KIFAP3 has also been identified as the target of mir-130a.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag20809 Product name: Recombinant human KIFAP3 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 491-792 aa of BC028679 Sequence: SQHDGPTKNLFIDYVGDLAAQISNDEEEEFVIECLGTLANLTIPDLDWELVLKEYKLVPYLKDKLKPGAAEDDLVLEVVIMIGTVSMDDSCAALLAKSGIIPALIELLNAQQEDDEFVCQIIYVFYQMVFHQATRDVIIKETQAPAYLIDLMHDKNNEIRKVCDNTLDIIAEYDEEWAKKIQSEKFRWHNSQWLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDLFYNSDGLIASEGAISPDFFNDYHLQNGDVVGQHSFPGSLGMDGFGQPVGILGRPATAYGFRPDEPYYYGYGS Predict reactive species\nFull Name: kinesin-associated protein 3\nCalculated Molecular Weight: 792 aa, 91 kDa\nObserved Molecular Weight: 91-100 kDa\nGenBank Accession Number: BC028679\nGene Symbol: KIFAP3\nGene ID (NCBI): 22920\nRRID: AB_2881387\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q92845\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888288845993,"sku":"60266-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-60266-1-ig","provider":"Iright","version":"1.0","type":"link"}