{"product_id":"proteintech-60326-1-ig","title":"Proteintech, 60326-1-Ig, Bestrophin-1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Bestrophin-1 (60326-1-Ig) by Proteintech is a Monoclonal antibody targeting Bestrophin-1 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n60326-1-Ig targets Bestrophin-1 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Y79 cells,  Transfected HEK-293 cells\nPositive IF\/ICC detected in: Y79 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBestrophin-1 (BEST1) is a 68 kDa transmembrane protein which belongs to the bestrophin family of anion channels. It is predominantly expressed in the basolateral membrane of the retinal pigment epithelium. Studies show that bestrophin 1 functions as a Ca(2+)-dependent Cl(-) channel and modulator of voltage-dependent L-type Ca(2+) channels. It may also contribute to the basolateral cell conductance in airway epithelial cells. This protein is encoded by the VMD2 gene. Mutations in VMD2 can lead to different types of retinal or macular degenerations, including Best vitelliform macular dystrophy (BMD), autosomal recessive bestrophinopathy (ARB), autosomal dominant vitreoretinochoroidopathy (ADVIRC) and adult-onset vitelliform macular dystrophy (AVMD).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag15129 Product name: Recombinant human BEST1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 319-498 aa of BC015220 Sequence: ANSRTKLLWPKRESLLHEGLPKNHKAAKQNVRGQEDNKAWKLKAVDAFKSAPLYQRPGYYSAPQTPLSPTPMFFPLEPSAPSKLHSVTGIDTKDKSLKTVSSGAKKSFELLSESDGALMEHPEVSQVRRKTVEFNLTDMPEIPENHLKEPLEQSPTNIHTTLKDHMDPYWALENRDEAHS Predict reactive species\nFull Name: bestrophin 1\nCalculated Molecular Weight: 585 aa, 68 kDa\nObserved Molecular Weight: 68 kDa\nGenBank Accession Number: BC015220\nGene Symbol: Bestrophin\/BEST1\nGene ID (NCBI): 7439\nRRID: AB_2881436\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O76090\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888037351593,"sku":"60326-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-60326-1-ig","provider":"Iright","version":"1.0","type":"link"}