{"product_id":"proteintech-60434-1-ig","title":"Proteintech, 60434-1-Ig, ATP5L Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATP5L (60434-1-Ig) by Proteintech is a Monoclonal antibody targeting ATP5L in IF\/ICC, ELISA applications with reactivity to human samples\n60434-1-Ig targets ATP5L in IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMitochondrial membrane ATP synthase (F1-Fo ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. It is composed of the soluble catalytic core, F1, and the membrane-spanning component and Fo, which comprises the proton channel. The Fo seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). ATP5L gene encodes ATP synthase subunit g of the Fo complex.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag9287 Product name: Recombinant human ATP5L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC015128 Sequence: MAQFVRNLVEKTPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPRAIQSLKKIANSAQTGSFKQLTVKEAVLNGLVATEVLMWFYVGEIIGKRGIIGYDV Predict reactive species\nFull Name: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit G\nCalculated Molecular Weight: 11 kDa\nGenBank Accession Number: BC015128\nGene Symbol: ATP5L\nGene ID (NCBI): 10632\nRRID: AB_3670259\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O75964\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888101150889,"sku":"60434-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-60434-1-ig","provider":"Iright","version":"1.0","type":"link"}