{"product_id":"proteintech-60681-2-ig","title":"Proteintech, 60681-2-Ig, SSTR1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SSTR1 (60681-2-Ig) by Proteintech is a Monoclonal antibody targeting SSTR1 in WB, ELISA applications with reactivity to human, mouse, rat, pig samples\n60681-2-Ig targets SSTR1 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig cerebellum tissue, mouse brain tissue,  pig brain tissue,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSSTR1 is a Gi\/o-coupled somatostatin receptor expressed in the brain, pancreas, and gastrointestinal epithelium, where it modulates neurotransmission, hormone secretion, and cellular proliferation. Through suppression of cAMP and regulation of Ca²⁺ signaling, SSTR1 mediates key inhibitory actions of somatostatin. Its expression in neuroendocrine tumors and roles in metabolic and neurological regulation underscore its clinical and biological relevance.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag30826 Product name: Recombinant human SSTR1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 328-391 aa of BC035618 Sequence: DNFKRSFQRILCLSWMDNAAEEPVDYYATALKSRAYSVEDFQPENLESGGVFRNGTCTSRITTL Predict reactive species\nFull Name: somatostatin receptor 1\nCalculated Molecular Weight: 391 aa, 43 kDa\nObserved Molecular Weight: 53 kDa\nGenBank Accession Number: BC035618\nGene Symbol: SSTR1\nGene ID (NCBI): 6751\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P30872\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888327250089,"sku":"60681-2-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-60681-2-ig","provider":"Iright","version":"1.0","type":"link"}